PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_1FFBFB058.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 493aa    MW: 52925.1 Da    PI: 9.8574
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_1FFBFB058.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1506.6e-16423466548
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                            +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk+
  Traes_1AL_1FFBFB058.1 423 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKKQ 466
                            79***************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.4E-15417466No hitNo description
SMARTSM003381.3E-12419491IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.702421466IPR004827Basic-leucine zipper domain
PfamPF001702.7E-13423466IPR004827Basic-leucine zipper domain
CDDcd147073.84E-27423477No hitNo description
SuperFamilySSF579595.44E-11423468No hitNo description
PROSITE patternPS000360426441IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
PLVGPLPPVA HGFASGPSRQ FLPSPPLPLP PWLPPPSPPP PFPNGRRQPQ PQPALTAARG  60
LDPAPGGRES RGCPVQFGAD SSWEVGAAEI RSPDLPPIRW SPSSPEDKSR RVVRRRVLPQ  120
CAVSWICGSA TCDRVFAGGK GAALGTVVPE VFVPIGATSP RDRRFMIQAM ASQSQAGGGG  180
GGGYAGPGQR GQAQQGLGRQ GSLYSLTLDE VQSQLTEPLL SMNLDELLKS VFPDGVDPVG  240
GVAGQSEPAP GLLRQGSITM PPDLSKKTVD EVWKGIQDSP KRSGEEGSRR RRERQPTFGE  300
MTLEDFLVKA GVVAEGHLKD PIDLPANMGA VGSSVIEAAA PSLNPGAHWL QQYLEPQHPR  360
MAGPFMASHL GPQPLSVATG AIMEPIYPDG QITSPMLDAL SDPQTPRRKR GASDGVTDKV  420
VERRQKRMIK NRESAARSRA RKQAYTNELE NKVSRLEEEN ERLKKQKELD MMITSAPPPE  480
PKYQLRRTSS APV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1277282DSPKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3071120.0EU307112.2 Triticum aestivum FD-like 2 protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568219.11e-155PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_014753472.11e-155PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES33e-78AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLW4ZMI50.0W4ZMI5_WHEAT; Uncharacterized protein
STRINGMLOC_6534.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.18e-73ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]